PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010102340.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family MYB
Protein Properties Length: 367aa    MW: 41246.5 Da    PI: 5.9188
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010102340.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.41.9e-142572148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEd++l ++    G g+W+ +ar  g+ R++k+c++rw +yl
   XP_010102340.1 25 KGLWSPEEDDKLMNYMLNNGQGCWSDVARNAGLQRCGKSCRLRWINYL 72
                     678*******************************************97 PP

2Myb_DNA-binding52.11.5e-1678121146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++++E+el+++++ +lG++ W+ Ia++++ gRt++++k++w++
   XP_010102340.1  78 RGAFSPQEEELIIHLHSLLGNR-WSQIAARLP-GRTDNEIKNFWNS 121
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.8772072IPR017930Myb domain
SuperFamilySSF466891.21E-2723119IPR009057Homeodomain-like
SMARTSM007171.3E-92474IPR001005SANT/Myb domain
PfamPF002493.6E-132572IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-222679IPR009057Homeodomain-like
CDDcd001672.71E-82872No hitNo description
PROSITE profilePS5129425.71673127IPR017930Myb domain
SMARTSM007174.0E-1677125IPR001005SANT/Myb domain
PfamPF002492.3E-1578121IPR001005SANT/Myb domain
CDDcd001671.18E-1180123No hitNo description
Gene3DG3DSA:1.10.10.605.4E-2680128IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MRKPDQGGST GKDNNNSNVV NKLRKGLWSP EEDDKLMNYM LNNGQGCWSD VARNAGLQRC  60
GKSCRLRWIN YLRPDLKRGA FSPQEEELII HLHSLLGNRW SQIAARLPGR TDNEIKNFWN  120
STVKKRLKNL STSSTPSPNT SDSSFELKDS MEAARGHNII PCRQLENNAN MFSSTYNLQD  180
SSPTSIQSSA INSHMIRPLP MLDLDHDHHH GGLINNMFGP NGYNNINPSS SCMAVHEIGI  240
NGSGDDHDNH GLFFGESGVF GSANIGSEAE IFVPPLESIS TTEESYTDHH HHQRIIYDDH  300
HRNSSYNNMV NNINSNIVNC NNNINIKAEN QSGVENYFQA ELTVGEWDLE DLMKDVSSFP  360
FLDFQIE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-26231275108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00336DAPTransfer from AT3G08500Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010102340.10.0Transcription factor
TrEMBLW9RIA10.0W9RIA1_9R
STRINGGLYMA11G14200.21e-119(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12870.17e-62myb domain protein 46